PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G12470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 681aa    MW: 73199.4 Da    PI: 5.8294
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G12470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.3e-2190145156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  OB08G12470.1  90 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 145
                   688999***********************************************999 PP

2START113.33.6e-362624101132
                   HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
         START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                   ela +a++elv++a+++ep+W+     e + ++e+++ f+++ +      ++ea+r+++vv+m+++ lve l+d++ qW+  +     +a+tlev+s
  OB08G12470.1 262 ELAVAAMEELVRMAQLGEPLWTPALsgEALGEEEYTRAFPRGLGpkspeLRSEASRETAVVIMNHVSLVEMLMDVG-QWTALFSsivsRAATLEVLS 357
                   57899*****************999899999********99888********************************.99999999999********* PP

                   TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE- CS
         START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvds 132
                   +g      galqlm+ae+q++splvp R++ f+Ry++q+++g+w++vdvS+d 
  OB08G12470.1 358 TGvagnhnGALQLMSAEFQMPSPLVPtRESQFLRYCKQHPDGTWAVVDVSLDG 410
                   **************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-2376145IPR009057Homeodomain-like
SuperFamilySSF466892.05E-2077147IPR009057Homeodomain-like
PROSITE profilePS5007117.39487147IPR001356Homeobox domain
SMARTSM003891.1E-2088151IPR001356Homeobox domain
CDDcd000865.58E-2089148No hitNo description
PfamPF000462.0E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PROSITE profilePS5084825.804253409IPR002913START domain
SuperFamilySSF559616.73E-19254410No hitNo description
CDDcd088757.48E-78257425No hitNo description
SMARTSM002342.9E-22262497IPR002913START domain
PfamPF018529.5E-28263410IPR002913START domain
SuperFamilySSF559613.08E-24442667No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MQSLLDGHHH QLPMPSVLQQ HHHNGQHLLD HQHQQLPPQA TTTSESDARA PRDELEMSKS  60
GGSDNLESGG GGGGGGGSGE DQDPNQRPRK KRYHRHTQHQ IQELEAFFKE CPHPDDKQRK  120
ELSRELGLEP LQVKFWFQNK RTQMKTQHER HENNALRAEN EKLRAENMRY KEALANASCP  180
NCGGPAAIGE MSFDEHHLRL ENARLRDEID RISAIAAKYV GKPAGAVAAA YPSNRSPLDH  240
MGMPGAGADV FGADFDKPLV IELAVAAMEE LVRMAQLGEP LWTPALSGEA LGEEEYTRAF  300
PRGLGPKSPE LRSEASRETA VVIMNHVSLV EMLMDVGQWT ALFSSIVSRA ATLEVLSTGV  360
AGNHNGALQL MSAEFQMPSP LVPTRESQFL RYCKQHPDGT WAVVDVSLDG LRSGGCPPAC  420
ERLASAMASN VASSGDAGVI TTSEGRRSML KLAERMVASF CGGVTASTTH QWTTLSGSGA  480
EDVRVMTRKS VDDPGRPPGI ILNAATSFWL PVPPSRVFDF LRDDSTRSEW DILSNGGVVQ  540
EMAHIANGRD HGNAVSLLRV NNANSNQSNM LILQECCTDA TGSYVIYAPV DVVAMNVVLN  600
GGDPDYVALL PSGFAILPDG PADGAAGGSL LTVAFQILVD SVPTAKLSLG SVATVNSLIA  660
CTVERIKAAI AGENAVAPCP L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16777SGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185630.0AK318563.1 Oryza sativa Japonica Group cDNA, clone: J075197C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695486.10.0PREDICTED: homeobox-leucine zipper protein ROC7
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLJ3MQ680.0J3MQ68_ORYBR; Uncharacterized protein
STRINGOB08G12470.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein